Structure of PDB 5wg9 Chain A

Receptor sequence

>5wg9A (length=179) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

GSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFM
YSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENR
FIDIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE
SRARIKTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 5wg9 Protein-Structure Assisted Optimization of 4,5-Dihydroxypyrimidine-6-Carboxamide Inhibitors of Influenza Virus Endonuclease.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 D119 I120	H44 D92 D103 I104
BS02	MN	A	E80 D108	E64 D92
BS03	KU4	A	A20 Y24 I38 H41 D108 D119 K134	A23 Y27 I41 H44 D92 D103 K118	MOAD: Ki=2.6uM PDBbind-CN: -logKd/Ki=5.59,Ki=2.6uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:5wg9, PDBe:5wg9, PDBj:5wg9
• PDBsum: 5wg9
• PubMed: 29215062
• UniProt: C3W5S0