Structure of PDB 5wfw Chain A

Receptor sequence

>5wfwA (length=180) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

RGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCF
MYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKEN
RFIDIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDE
ESRARIKTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 5wfw Protein-Structure Assisted Optimization of 4,5-Dihydroxypyrimidine-6-Carboxamide Inhibitors of Influenza Virus Endonuclease.
• Chain: A
• Resolution: 2.292 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 D119 I120	H45 D93 D104 I105
BS02	MN	A	E80 D108	E65 D93
BS03	GYA	A	A20 Y24 E26 I38 H41 D108 K134	A24 Y28 E30 I42 H45 D93 K119	MOAD: Ki=0.8uM PDBbind-CN: -logKd/Ki=6.10,Ki=0.8uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:5wfw, PDBe:5wfw, PDBj:5wfw
• PDBsum: 5wfw
• PubMed: 29215062
• UniProt: C3W5S0