Structure of PDB 5weh Chain A

Receptor sequence

>5wehA (length=547) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

RGFFTRWFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFM
CAEHLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIP
ALFGGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGN
GQLGSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFL
NMRAPGMTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTF
FQPSGGGDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGY
LPMVYAMVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKI
FSWIATMWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDT
YYVVAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVG
ANLTFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLG
VIFYTLTRGARVTANNYWNEHADTLEWTLTSPPPEHTFEQLPKREDW

3D structure

PDB

5weh Role of conformational change and K-path ligands in controlling cytochrome c oxidase activity.

Chain

Resolution

3.45 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y33 I43 F47 M51 I99 H102 N121 D132 N139 S142 Y146 W172 S200 S201 G204 T211 H284 E286 Y288 S299 P315 H333 H334 T359 K362 H419 F420 H421 R481
Catalytic site (residue number reindexed from 1)	Y20 I30 F34 M38 I86 H89 N108 D119 N126 S129 Y133 W159 S187 S188 G191 T198 H271 E273 Y275 S286 P302 H320 H321 T346 K349 H406 F407 H408 R468
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEA	A	G37 G38 V45 T48 M51 R52 W95 I99 H102 G103 M106 M107 V111 W172 Y414 F420 H421 S425 V429 M460 F468 R481 R482 F508	G24 G25 V32 T35 M38 R39 W82 I86 H89 G90 M93 M94 V98 W159 Y401 F407 H408 S412 V416 M447 F455 R468 R469 F495
BS02	HEA	A	V287 H333 T352 A356 T359 G360 I363 F391 T392 G395 V396 G398 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	V274 H320 T339 A343 T346 G347 I350 F378 T379 G382 V383 G385 L388 S389 D394 H398 V403 H406 F407 V410 M411 R468
BS03	CU1	A	H284 H333 H334	H271 H320 H321
BS04	MG	A	H411 D412	H398 D399
BS05	CA	A	E54 A57 P58 G59 Q61	E41 A44 P45 G46 Q48

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005515	protein binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5weh, PDBe:5weh, PDBj:5weh
PDBsum	5weh
PubMed	28842531
UniProt	P33517\|COX1_CERSP Cytochrome c oxidase subunit 1 (Gene Name=ctaD)

[Back to BioLiP]