Structure of PDB 5we9 Chain A

Receptor sequence

>5we9A (length=178) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD
GGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE
IGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRA
RIKTRLFTIRQEMASRSLWDSFRQSERA

3D structure

• PDB: 5we9 Protein-Structure Assisted Optimization of 4,5-Dihydroxypyrimidine-6-Carboxamide Inhibitors of Influenza Virus Endonuclease.
• Chain: A
• Resolution: 1.804 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H41 D89 E100 I101
BS02	MG	A	E80 D108	E61 D89
BS03	GY7	A	Y24 H41 E80 D108 E119 K134	Y24 H41 E61 D89 E100 K115	MOAD: Ki=0.06uM PDBbind-CN: -logKd/Ki=7.22,Ki=0.06uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:5we9, PDBe:5we9, PDBj:5we9
• PDBsum: 5we9
• PubMed: 29215062
• UniProt: C3W5S0