Structure of PDB 5w9q Chain A

Receptor sequence
>5w9qA (length=56) Species: 9606 (Homo sapiens) [Search protein sequence]
RQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAM
KRLLPS
3D structure
PDB5w9q DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R333 Q334 R336 K359 R369 Q370 R1 Q2 R4 K27 R37 Q38 PDBbind-CN: Kd=0.6uM
BS02 dna A R333 R369 R384 R1 R37 R52 PDBbind-CN: Kd=0.6uM
BS03 ZN A C350 C353 C356 C372 C18 C21 C24 C40
BS04 ZN A C338 C341 C344 C377 C6 C9 C12 C45
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5w9q, PDBe:5w9q, PDBj:5w9q
PDBsum5w9q
PubMed29276034
UniProtQ9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (Gene Name=MBD1)

[Back to BioLiP]