Structure of PDB 5w9g Chain A

Receptor sequence

>5w9gA (length=178) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

RGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCF
MYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKEN
RFIEIGVTRREVHIYYLEKANKIKKTHIHIFSFTGEEMATKADYTLDEES
RARIKTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 5w9g Protein-Structure Assisted Optimization of 4,5-Dihydroxypyrimidine-6-Carboxamide Inhibitors of Influenza Virus Endonuclease.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H45 D93 E104 I105
BS02	MN	A	E80 D108	E65 D93
BS03	KU2	A	Y24 I38 H41 E80 D108 E119 Y130	Y28 I42 H45 E65 D93 E104 Y115	MOAD: Ki=0.15uM PDBbind-CN: -logKd/Ki=6.82,Ki=0.15uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:5w9g, PDBe:5w9g, PDBj:5w9g
• PDBsum: 5w9g
• PubMed: 29215062
• UniProt: C3W5S0