Structure of PDB 5w3q Chain A

Receptor sequence
>5w3qA (length=159) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MISLIAALAVDRVIGMENAMPWNLPADFAWFKRNTLNKPVIMGRHTWESI
GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVY
EQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHS
YCFEILERR
3D structure
PDB5w3q Defining the Structural Basis for Allosteric Product Release from E. coli Dihydrofolate Reductase Using NMR Relaxation Dispersion.
ChainA
Resolution1.401 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) I5 M20 W22 D27 F28 F31 L54 I91 T113
Catalytic site (residue number reindexed from 1) I5 M20 W22 D27 F28 F31 L54 I91 T113
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NDP A A6 A7 I14 N18 A19 M20 G43 R44 H45 T46 L62 S63 S64 Q65 K76 I94 G96 G97 R98 V99 Q102 A6 A7 I14 N18 A19 M20 G43 R44 H45 T46 L62 S63 S64 Q65 K76 I94 G96 G97 R98 V99 Q102
BS02 CA A D116 H149 D116 H149
Gene Ontology
Molecular Function
GO:0004146 dihydrofolate reductase activity
GO:0005515 protein binding
GO:0005542 folic acid binding
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
GO:0051870 methotrexate binding
GO:0051871 dihydrofolic acid binding
GO:0070401 NADP+ binding
GO:0070402 NADPH binding
Biological Process
GO:0006730 one-carbon metabolic process
GO:0009257 10-formyltetrahydrofolate biosynthetic process
GO:0009410 response to xenobiotic stimulus
GO:0031427 response to methotrexate
GO:0046452 dihydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
GO:0046656 folic acid biosynthetic process
GO:0046677 response to antibiotic
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5w3q, PDBe:5w3q, PDBj:5w3q
PDBsum5w3q
PubMed28737940
UniProtP0ABQ4|DYR_ECOLI Dihydrofolate reductase (Gene Name=folA)

[Back to BioLiP]