Structure of PDB 5w1d Chain A

Receptor sequence

>5w1dA (length=405) Species: 10090 (Mus musculus)

PSYQGYILESAPVGATISESLNLTTPLRIVALELHLFLNDYTSVFTVTPT
GITRYLTLLQPVDREEQQTYTFLITAFDGVQESEPVVVNIRVMDANDNTP
TFPEISYDVYVYTDMSPGDSVIQLTAVDADEGSNGEISYEILVGGKGDFV
INKTTGLVSIAPGVELIVGQTYALTVQASDNAPPAERRHSICTVYIEVLP
PNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDP
QRVFNLSETTGILSLGKALDRESTDRYILIVTASDGRPDGTSTATVNIVV
TDVNDNAPVFDPYLPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLG
NFNNLFRITSNGSIYTAVKLNREARDHYELVVVATDGAVHPRHSTLTLYI
KVLDI

3D structure

• PDB: 5w1d Structural determinants of protocadherin-15 mechanics and function in hearing and balance perception.
• Chain: A
• Resolution: 3.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	N690 N692 D722 D724 N728 D772	N304 N306 D336 D338 N342 D386
BS02	CA	A	E606 E658 D688 V689 D691 D724	E220 E272 D302 V303 D305 D338
BS03	CA	A	E606 D656 E658 D691	E220 D270 E272 D305
BS04	CA	A	Q590 S591 D621 E623 D625 D671	Q204 S205 D235 E237 D239 D285
BS05	CA	A	N482 N484 D514 D516 N520 D566	N96 N98 D128 D130 N134 D180
BS06	CA	A	E385 D480	E9 D94

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding

Biological Process

• GO:0007155 cell adhesion
• GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:5w1d, PDBe:5w1d, PDBj:5w1d
• PDBsum: 5w1d
• PubMed: 32963095
• UniProt: Q99PJ1|PCD15_MOUSE Protocadherin-15 (Gene Name=Pcdh15)