Structure of PDB 5w0g Chain A |
>5w0gA (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQKN FAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRP |
|
PDB | 5w0g Cancer-Associated Mutations Mapped on High-Resolution Structures of the U2AF2 RNA Recognition Motifs. |
Chain | A |
Resolution | 1.07 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E163 D167 |
E18 D22 |
|
|
|
|