Structure of PDB 5vzo Chain A

Receptor sequence
>5vzoA (length=153) Species: 9755 (Physeter catodon) [Search protein sequence]
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK
TEAEMKASEDLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIP
IKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG
YQG
3D structure
PDB5vzo Nitrosyl Myoglobins and Their Nitrite Precursors: Crystal Structural and Quantum Mechanics and Molecular Mechanics Theoretical Investigations of Preferred Fe -NO Ligand Orientations in Myoglobin Distal Pockets.
ChainA
Resolution1.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.11.1.-
1.7.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A K42 F43 R45 T67 V68 L89 S92 H93 H97 I99 Y103 K42 F43 R45 T67 V68 L89 S92 H93 H97 I99 Y103
BS02 NO2 A R31 E109 R31 E109
BS03 NO2 A R31 K34 R31 K34
BS04 NO2 A S92 K96 S92 K96
BS05 NO2 A L86 D141 L86 D141
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0098809 nitrite reductase activity
Biological Process
GO:0015671 oxygen transport
GO:0019430 removal of superoxide radicals
Cellular Component
GO:0005737 cytoplasm
GO:0016528 sarcoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vzo, PDBe:5vzo, PDBj:5vzo
PDBsum5vzo
PubMed29999305
UniProtP02185|MYG_PHYMC Myoglobin (Gene Name=MB)

[Back to BioLiP]