Structure of PDB 5vx0 Chain A

Receptor sequence

>5vx0A (length=169) Species: 9606 (Homo sapiens) [Search protein sequence]

GPLGSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQ
PSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIAT
SLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHS
IARWIAQRGGWVAALNLGN

3D structure

PDB

5vx0 Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.

Chain

Resolution

1.599 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	R42 I81 I85 N86 Y89 E92 F93 M96 H99 L100 I114 S117 L118 S121 N124 G126 R127 A130 F134 R137 L183 G184	R26 I65 I69 N70 Y73 E76 F77 M80 H83 L84 I98 S101 L102 S105 N108 G110 R111 A114 F118 R121 L167 G168
BS02	MG	A	V27 D30 G176 W177	V11 D14 G160 W161
BS03	MG	A	T103 A104	T87 A88
BS04	MG	A	N124 W125	N108 W109

Gene Ontology

	Biological Process
GO:0042981	regulation of apoptotic process

View graph for
Biological Process

External links

PDB	RCSB:5vx0, PDBe:5vx0, PDBj:5vx0
PDBsum	5vx0
PubMed	29149594
UniProt	Q16611\|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]