Structure of PDB 5vvm Chain A

Receptor sequence

>5vvmA (length=298) Species: 9606 (Homo sapiens) [Search protein sequence]

NPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVP
NQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPESVSVPN
AKLTVNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKG
LNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASD
NGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEDVPVGTIILTVTATDAD
SGNFALIEYSLGDGAINPTTGDIYVLALAKDNPGDVASNRRENSVQVV

3D structure

PDB

5vvm Zooming in on Cadherin-23: Structural Diversity and Potential Mechanisms of Inherited Deafness.

Chain

Resolution

3.54 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	E2162 N2224 E2226 D2265	E10 N72 E74 D112
BS02	CA	A	E2162 E2226 D2262 V2263 D2265 D2301	E10 E74 D109 V110 D112 D148
BS03	CA	A	N2264 N2266 D2299 D2301 N2305 D2353	N111 N113 D146 D148 N152 D200
BS04	CA	A	E2284 D2338 E2340 D2374	E131 D185 E187 D221
BS05	CA	A	E2284 E2340 D2371 I2372 D2374 D2407	E131 E187 D218 I219 D221 D250
BS06	CA	A	N2373 N2375 D2405 D2407 F2411 D2456	N220 N222 D248 D250 F254 D281

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding

	Biological Process
GO:0007155	cell adhesion
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5vvm, PDBe:5vvm, PDBj:5vvm
PDBsum	5vvm
PubMed	30033219
UniProt	Q9H251\|CAD23_HUMAN Cadherin-23 (Gene Name=CDH23)

[Back to BioLiP]