Structure of PDB 5vvl Chain A

Receptor sequence

>5vvlA (length=264) Species: 83333 (Escherichia coli K-12)

SMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAV
RLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKV
VRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRY
DPWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVY
DIADIIKFDTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLIPL
IEDVLAAGEIQPPA

3D structure

• PDB: 5vvl Structures of the CRISPR genome integration complex.
• Chain: A
• Resolution: 3.31 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y22 G23 K37 G57 R59	Y7 G8 K22 G42 R44
BS02	dna	A	P56 G79 E80 R84 Y86 R163 Y165 D166 W170 S181 T184 S185 Y188 H208 T209 K211 Y217 D244 R245 R248	P41 G64 E65 R69 Y71 R148 Y150 D151 W153 S164 T167 S168 Y171 H191 T192 K194 Y200 D227 R228 R231
BS03	dna	A	E135 Q136 R138 G139 E141 G142 S143 V145 R146 W160 G162	E120 Q121 R123 G124 E126 G127 S128 V130 R131 W145 G147

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5vvl, PDBe:5vvl, PDBj:5vvl
• PDBsum: 5vvl
• PubMed: 28729350
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)