Structure of PDB 5vvk Chain A

Receptor sequence

>5vvkA (length=266) Species: 83333 (Escherichia coli K-12)

SMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAV
RLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKV
VRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRY
DPKDWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSF
VYDIADIIKFDTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLI
PLIEDVLAAGEIQPPA

3D structure

• PDB: 5vvk Structures of the CRISPR genome integration complex.
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y22 G23 Q24 K37 G57 R59	Y7 G8 Q9 K22 G42 R44
BS02	dna	A	Y22 G79 E80 R84 Y86 R163 Y165 D166 W170 S181 T184 Y188 H208 T209 K211 Y217 R245 R248	Y7 G64 E65 R69 Y71 R148 Y150 D151 W155 S166 T169 Y173 H193 T194 K196 Y202 R230 R233
BS03	dna	A	E135 Q136 R138 G139 I140 G142 S143 V145 R146 Y149 W160 G162	E120 Q121 R123 G124 I125 G127 S128 V130 R131 Y134 W145 G147

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5vvk, PDBe:5vvk, PDBj:5vvk
• PDBsum: 5vvk
• PubMed: 28729350
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)