Structure of PDB 5vs7 Chain A |
>5vs7A (length=119) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] |
GYDEIEELKSKNEVLTNLLNKLIAFDKKRIFLYPVNVQLVPDYLNVIKEP MDFTTMKQKLQNFKYKSFQEFEKDVLLIINNCYTYNDPSTIYYKFAEDIE TYYKKLNIKIQTKYMNIHL |
|
PDB | 5vs7 Bromodomain of PF3D7_1475600 from Plasmodium falciparum complexed with peptide H4K5ac |
Chain | A |
Resolution | 2.04 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
D42 Y85 N86 Y92 |
D42 Y85 N86 Y92 |
|
|
|