Structure of PDB 5vrj Chain A

Receptor sequence

>5vrjA (length=179) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

GSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFM
YSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENR
FIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE
SRARIKTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 5vrj Identification of the I38T PA Substitution as a Resistance Marker for Next-Generation Influenza Virus Endonuclease Inhibitors.
• Chain: A
• Resolution: 2.302 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	H41 D108 E119 I120	H44 D92 E103 I104
BS02	MG	A	E80 D108	E64 D92
BS03	R07	A	A20 Y24 A37 I38 H41 E80 D108 E119 K134	A23 Y27 A40 I41 H44 E64 D92 E103 K118

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:5vrj, PDBe:5vrj, PDBj:5vrj
• PDBsum: 5vrj
• PubMed: 29691337
• UniProt: C3W5S0