Structure of PDB 5vjj Chain A

Receptor sequence
>5vjjA (length=77) Species: 5261 (Melampsora lini) [Search protein sequence]
NPNQELGVVQCLCRRIAPLTQPPFGVRCRATLNCPCDYIGDCPGPAEQYM
YRCPNCGPRSHVACSGVHQGTCQQVHP
3D structure
PDB5vjj Crystal structure of the Melampsora lini effector AvrP reveals insights into a possible nuclear function and recognition by the flax disease resistance protein P.
ChainA
Resolution2.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C36 C38 C78 C81 C11 C13 C53 C56
BS02 ZN A C53 C67 C89 H93 C28 C42 C64 H68
BS03 ZN A C59 C61 C97 H101 C34 C36 C72 H76
External links