Structure of PDB 5vik Chain A

Receptor sequence
>5vikA (length=296) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence]
NCEHEEIHLAGSIQPHGALLVVSEHDHRVIQASANAAEFLNLGSVLGVPL
AEIDGDLLIKILPHLDPTAEGMPVAVRCRIGNPSTEYCGLMHRPPEGGLI
IELERAGPSIDLSGTLAPALERIRTAGSLRALCDDTVLLFQQCTGYDRVM
VYRFDEQGHGLVFSECHVPGLESYFGNRYPSSLVPQMARQLYVRQRVRVL
VDVTYQPVPLEPRLSPLTGRDLDMSGCFLRSMSPIHLQFLKDMGVRATLA
VSLVVGGKLWGLVVCHHYLPRFIRFELRAICKRLAERIATRITALE
3D structure
PDB5vik Designing brighter near-infrared fluorescent proteins: insights from structural and biochemical studies.
ChainA
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BLA A C20 I25 Y170 Y197 S200 L201 V202 P203 Y210 R216 R248 M250 S251 I253 H254 F257 A268 V282 H284 C2 I7 Y152 Y179 S182 L183 V184 P185 Y192 R198 R230 M232 S233 I235 H236 F239 A250 V264 H266
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Feb 21 18:12:58 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5vik', asym_id = 'A', title = 'Designing brighter near-infrared fluorescent pro...insights from structural and biochemical studies.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5vik', asym_id='A', title='Designing brighter near-infrared fluorescent pro...insights from structural and biochemical studies.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006355,0009584', uniprot = '', pdbid = '5vik', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006355,0009584', uniprot='', pdbid='5vik', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>