Structure of PDB 5vdf Chain A |
>5vdfA (length=72) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
AEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTL PYDFILEKIKKTGKEVRSGKQL |
|
PDB | 5vdf The crystal structures of a copper-bound metallochaperone from Saccharomyces cerevisiae. |
Chain | A |
Resolution | 1.93 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
C15 C18 |
C14 C17 |
|
|
|
|