Structure of PDB 5vab Chain A

Receptor sequence
>5vabA (length=54) Species: 3847 (Glycine max) [Search protein sequence]
GAMGSVSCEECGGGHSPSKLLLCDKCDRGYHLFCLRPILPSVPKGSWFCP
SCSN
3D structure
PDB5vab Molecular basis for the methylation specificity of ATXR5 for histone H3.
ChainA
Resolution1.702 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G18 A19 M20 V23 G31 P34 S35 L37 L38 L39 C40 D41 D44 P60 G62 G1 A2 M3 V6 G14 P17 S18 L20 L21 L22 C23 D24 D27 P43 G45
BS02 ZN A C25 C28 H48 C51 C8 C11 H31 C34
BS03 ZN A C40 C43 C66 C69 C23 C26 C49 C52
External links