Structure of PDB 5va0 Chain A

Receptor sequence
>5va0A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNL
3D structure
PDB5va0 Tethering not required: the glucocorticoid receptor binds directly to activator protein-1 recognition motifs to repress inflammatory genes.
ChainA
Resolution2.295 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A C431 H432 Y433 K446 C13 H14 Y15 K28 PDBbind-CN: Kd=402nM
BS02 dna A S440 F444 R447 R470 K471 R477 S22 F26 R29 R52 K53 R59 PDBbind-CN: Kd=402nM
BS03 ZN A C421 C424 C438 C441 C3 C6 C20 C23
BS04 ZN A C457 C463 C473 C476 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5va0, PDBe:5va0, PDBj:5va0
PDBsum5va0
PubMed28591827
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]