Structure of PDB 5v9j Chain A

Receptor sequence

>5v9jA (length=257) Species: 9606 (Homo sapiens)

ERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNI
THLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECN
HACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYV
GELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVP
VRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCG
SPKCRHS

3D structure

• PDB: 5v9j Crystal structure of catalytic domain of GLP with MS0105
• Chain: A
• Resolution: 1.74 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1155 Y1242
• Catalytic site (residue number reindexed from 1): Y149 Y233
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAM	A	M1136 G1137 W1138 S1172 Y1173 R1197 F1198 N1200 H1201 Y1242 F1246 C1256 R1257	M130 G131 W132 S166 Y167 R188 F189 N191 H192 Y233 F237 C247 R248
BS02	90P	A	D1162 A1165 D1166 D1171 L1174 D1176 C1186 R1245 F1246 I1249 K1250	D156 A159 D160 D165 L168 D170 C177 R236 F237 I240 K241
BS03	ZN	A	C1062 C1075 C1105 C1109	C56 C69 C99 C103
BS04	ZN	A	C1068 C1105 C1111 C1115	C62 C99 C105 C109
BS05	ZN	A	C1062 C1064 C1068 C1073	C56 C58 C62 C67
BS06	ZN	A	C1203 C1256 C1258 C1263	C194 C247 C249 C254

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046974 histone H3K9 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5v9j, PDBe:5v9j, PDBj:5v9j
• PDBsum: 5v9j
• UniProt: Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 (Gene Name=EHMT1)