Structure of PDB 5v91 Chain A |
>5v91A (length=138) Species: 573 (Klebsiella pneumoniae) [Search protein sequence] |
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLS LDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGA SHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFE |
|
PDB | 5v91 Structure and Dynamics of FosA-Mediated Fosfomycin Resistance in Klebsiella pneumoniae and Escherichia coli. |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H67 E98 E113 |
H67 E98 E113 |
|
|
|
|