Structure of PDB 5v4d Chain A |
>5v4dA (length=127) Species: 632 (Yersinia pestis) [Search protein sequence] |
NAKSVIETKNAPSAIGPYSQAICFNGILYASGQIPINPDTGDLVENDIEK QTRQVLKNIDAVLLQAGTTKDKIVKTTIFITNINNSSQVNDIYADYFKGT IFPARSTVEVSALPKGALVEIEVIAGV |
|
PDB | 5v4d Crystal Structure of the Protein of Unknown Function of the Conserved Rid Protein Family YyfA from Yersinia pestis |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D90 D94 |
D91 D95 |
|
|
|
|