Structure of PDB 5uwk Chain A

Receptor sequence
>5uwkA (length=160) Species: 9606 (Homo sapiens) [Search protein sequence]
FPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRL
HDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDET
WTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGFMLPDDDV
QGIQSLYGPG
3D structure
PDB5uwk Structure-Based Design and Synthesis of Potent and Selective Matrix Metalloproteinase 13 Inhibitors.
ChainA
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H222 E223 H226 H232
Catalytic site (residue number reindexed from 1) H116 E117 H120 H126
Enzyme Commision number 3.4.24.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H222 H226 H232 H116 H120 H126
BS02 ZN A H172 D174 H187 H200 H66 D68 H81 H94
BS03 CA A D179 G180 S182 L184 D202 E205 D73 G74 S76 L78 D96 E99
BS04 CA A D128 D203 E205 D22 D97 E99
BS05 CA A D162 N194 G196 D198 D56 N88 G90 D92
BS06 8OM A L184 L185 A186 H222 E223 H226 H232 L239 F241 I243 Y244 T245 T247 P255 L78 L79 A80 H116 E117 H120 H126 L133 F135 I137 Y138 T139 T141 P146 MOAD: Ki=2.3nM
PDBbind-CN: -logKd/Ki=8.64,Ki=2.3nM
BindingDB: IC50=2.2nM,Ki=2.3nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uwk, PDBe:5uwk, PDBj:5uwk
PDBsum5uwk
PubMed28653849
UniProtP45452|MMP13_HUMAN Collagenase 3 (Gene Name=MMP13)

[Back to BioLiP]