Structure of PDB 5uw2 Chain A |
>5uw2A (length=112) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] |
PTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIE QRYNHIPDTSSLSIRTSGLLGEQYLALNVGFELGTAILKDGDTIQDTKSA MVLEDLIGQFLY |
|
PDB | 5uw2 Architectures of Lipid Transport Systems for the Bacterial Outer Membrane. |
Chain | A |
Resolution | 2.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
T41 D130 |
T4 D90 |
|
|
|
|