Structure of PDB 5uua Chain A

Receptor sequence

>5uuaA (length=316) Species: 1427 (Bacillus thermoproteolyticus)

ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTL
PGSLWADADNQFFASYDAPAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAI
RSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTD
YTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGD
SLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTH
YGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTS
QEVASVKQAFDAVGVK

3D structure

• PDB: 5uua The impact of cryosolution thermal contraction on proteins and protein crystals: volumes, conformation and order.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H142 E143 H146 Y157 E166 D226 H231
• Catalytic site (residue number reindexed from 1): H142 E143 H146 Y157 E166 D226 H231
• Enzyme Commision number: 3.4.24.27: thermolysin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D138 E177 D185 E187 E190	D138 E177 D185 E187 E190
BS02	ZN	A	E177 N183 D185 E190	E177 N183 D185 E190
BS03	ZN	A	D57 D59 Q61	D57 D59 Q61
BS04	CA	A	Y193 T194 I197 D200	Y193 T194 I197 D200
BS05	ZN	A	H142 H146 E166	H142 H146 E166
BS06	ZN	A	D226 H231	D226 H231
BS07	XYP	A	Q283 A287	Q283 A287
BS08	XYP	A	N159 E160 R220 T222 G228	N159 E160 R220 T222 G228
BS09	XYP	A	H216 S218	H216 S218
BS10	XYP	A	L175 F178 R260 D261	L175 F178 R260 D261
BS11	XYP	A	A209 G212	A209 G212
BS12	XYP	A	I1 T2 G3 N33	I1 T2 G3 N33

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:5uua, PDBe:5uua, PDBj:5uua
• PDBsum: 5uua
• PubMed: 30198901
• UniProt: P00800|THER_BACTH Thermolysin (Gene Name=npr)