Structure of PDB 5uta Chain A

Receptor sequence

>5utaA (length=153) Species: 9755 (Physeter catodon)

VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK
TEAEMKASEDLKKQGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIP
IKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG
YQG

3D structure

• PDB: 5uta Nitrosyl Myoglobins and Their Nitrite Precursors: Crystal Structural and Quantum Mechanics and Molecular Mechanics Theoretical Investigations of Preferred Fe -NO Ligand Orientations in Myoglobin Distal Pockets.
• Chain: A
• Resolution: 1.81 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  1.7.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F43 R45 Q64 T67 L89 S92 H93 H97 I99 Y103	F43 R45 Q64 T67 L89 S92 H93 H97 I99 Y103
BS02	NO2	A	F43 Q64 V68	F43 Q64 V68
BS03	NO2	A	R31 E109	R31 E109
BS04	NO2	A	R31 K34	R31 K34
BS05	NO2	A	H82 A134 L137 F138	H82 A134 L137 F138
BS06	NO2	A	E83 D141	E83 D141
BS07	NO2	A	L104 S108 F138	L104 S108 F138
BS08	NO2	A	S92 K96	S92 K96
BS09	NO2	A	L89 H93 I142	L89 H93 I142

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0019430 removal of superoxide radicals

Cellular Component

• GO:0005737 cytoplasm
• GO:0016528 sarcoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:5uta, PDBe:5uta, PDBj:5uta
• PDBsum: 5uta
• PubMed: 29999305
• UniProt: P02185|MYG_PHYMC Myoglobin (Gene Name=MB)