Structure of PDB 5uqp Chain A |
>5uqpA (length=110) Species: 101510 (Rhodococcus jostii RHA1) [Search protein sequence] |
SVNGRLPELDFENRPSGAKLGIFDLPKLEVSVAPFTLAHIRVPGGVTTAE DHHEVREIWLVQSGSGILTLDGVRSRVRAGDTLYYESYRRHQLHNDGDSP VEIVSIWWRP |
|
PDB | 5uqp The crystal structure of cupin protein from Rhodococcus jostii RHA1 |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D63 H65 E69 H103 |
D51 H53 E57 H91 |
|
|
|
|