Structure of PDB 5ujp Chain A |
>5ujpA (length=114) Species: 1703937 (Streptomyces sp. CB03234) [Search protein sequence] |
SNALFSVPVSDQEKAKDFYVETVGFDLLADQPGVHGRWLQVAPKGADTSL VLVDWFPTMPPGSLRGLLLRTDDVDADCARLQERGVAVDGPKNTPWGRQA MFSDPDGNVIGLNQ |
|
PDB | 5ujp The crystal structure of a glyoxalase/bleomycin resistance protein from Streptomyces sp. CB03234 |
Chain | A |
Resolution | 1.42 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
S5 D51 T52 |
S1 D47 T48 |
|
|
|
|