Structure of PDB 5uhu Chain A

Receptor sequence

>5uhuA (length=393) Species: 28040 (Micromonospora griseorubida)

EPRAYPFNDVHGLTLAGRYGELQETEPVSRVRPPYGEEAWLVTRYEDVRA
VLGDGRFVRGPSMTRDEPRTRPEMVKGGLLSMDPPEHSRLRRLVVKAFTA
RRAESLRPRAREIAHELVDQMAATGQPADLVAMFARQLPVRVICELLGVP
SADHDRFTRWSGAFLSTAEVTAEEMQEAAEQAYAYMGDLIDRRRKEPTDD
LVSALVQARDQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRP
ELRRQLLDRPELIPSAVEELTRWVPLGVGTAFPRYAVEDVTLRGVTIRAG
EPVLASTGAANRDQAQFPDADRIDVDRTPNQHLGFGHGVHHCLGAPLARV
ELQVALEVLLQRLPGIRLGIPETQLRWSEGMLLRGPLELPVVW

3D structure

• PDB: 5uhu Solution Conformations and Dynamics of Substrate-Bound Cytochrome P450 MycG.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Catalytic site (original residue number in PDB): S170 A234 E237 S238 T239 V282 C346 L347 G348 E355 L387
• Catalytic site (residue number reindexed from 1): S166 A230 E233 S234 T235 V278 C342 L343 G344 E351 L383
• Enzyme Commision number: 1.14.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L83 H91 R95 F102 L231 G235 S238 T239 Q242 A285 F286 R288 H345 C346 L347 G348	L79 H87 R91 F98 L227 G231 S234 T235 Q238 A281 F282 R284 H341 C342 L343 G344
BS02	MIV	A	R75 K80 L84 A234 G384 L386	R71 K76 L80 A230 G380 L382

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0017000 antibiotic biosynthetic process

External links

• PDB: RCSB:5uhu, PDBe:5uhu, PDBj:5uhu
• PDBsum: 5uhu
• PubMed: 28488849
• UniProt: Q59523|MYCG_MICGR Mycinamicin IV hydroxylase/epoxidase (Gene Name=mycG)