Structure of PDB 5uhs Chain A |
>5uhsA (length=81) Species: 456481 (Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)') [Search protein sequence] |
MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFV YGILRSALPIILANVVTLFFVTIILYYKLTE |
|
PDB | 5uhs Mechanism of Substrate Translocation in an Alternating Access Transporter. |
Chain | A |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BGC |
A |
F41 W48 |
F41 W48 |
|
|
|
|