Structure of PDB 5uep Chain A |
>5uepA (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] |
SHMEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPM DMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQD VFEMRFAKM |
|
PDB | 5uep Complex structure of BRD4_BD2_A-581577 |
Chain | A |
Resolution | 1.77 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
88P |
A |
P375 F376 V380 N433 |
P27 F28 V32 N85 |
BindingDB: Ki=25000nM |
|
|