Structure of PDB 5ue9 Chain A

Receptor sequence

>5ue9A (length=306) Species: 1360 (Lactococcus lactis subsp. lactis)

NRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHP
RFGNPTPRVAETASGMLNAIGLQNPGLEVIMAEKLPWLNENFPDLPIIAN
VAGSEEDDYVAVCAKIGDAPNVKVIELNISCPNVKHGGQAFGTDPDVAAA
LVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRF
DLKTRKPVLANITGGLSGPAIKPVALKLIHQVAQVVDIPIIGMGGVESAQ
DVLEMYMAGASAVAVGTANFADPFVCPKIIEKLPEVMDQYGIDSLENLIQ
EVKNSK

3D structure

• PDB: 5ue9 Isoleucine 74 Plays a Key Role in Controlling Electron Transfer Between Lactococcus lactis Dihydroorotate Dehydrogenase 1B Subunits
• Chain: A
• Resolution: 2.72 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K48 N72 L76 C135 N137 V138 K170 N197
• Catalytic site (residue number reindexed from 1): K44 N68 L72 C131 N133 V134 K166 N193
• Enzyme Commision number: 1.3.1.14: dihydroorotate dehydrogenase (NAD(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	S24 G25 C26 K48 A49 N72 N104 N132 K170 I196 T198 S221 M247 G248 G249 G270 T271	S20 G21 C22 K44 A45 N68 N100 N128 K166 I192 T194 S217 M243 G244 G245 G266 T267

Gene Ontology

Molecular Function

• GO:0004152 dihydroorotate dehydrogenase activity
• GO:0004589 dihydroorotate dehydrogenase (NAD+) activity
• GO:0016491 oxidoreductase activity
• GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006222 UMP biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5ue9, PDBe:5ue9, PDBj:5ue9
• PDBsum: 5ue9
• UniProt: Q9CFW8|PYRDB_LACLA Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (Gene Name=pyrDB)