Structure of PDB 5ue2 Chain A

Receptor sequence

>5ue2A (length=247) Species: 9606 (Homo sapiens) [Search protein sequence]

PQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPI
TGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFD
GPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHALGHSL
GMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

3D structure

PDB

5ue2 Glycan Activation of a Sheddase: Electrostatic Recognition between Heparin and proMMP-7.

Chain

Resolution

N/A

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H194 A195 H198 H204
Catalytic site (residue number reindexed from 1)	H194 A195 H198 H204
Enzyme Commision number	3.4.24.23: matrilysin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SGN	A	E13 D17 R21 Y25	E13 D17 R21 Y25
BS02	IDS	A	F149 G151	F149 G151
BS03	CA	A	D133 G165 L166 G167 G168 D169	D133 G165 L166 G167 G168 D169
BS04	CA	A	D150 G151 P152 G153 N154 T155 D173 E176	D150 G151 P152 G153 N154 T155 D173 E176
BS05	ZN	A	H143 D145 H158 H171	H143 D145 H158 H171
BS06	ZN	A	C67 H194 H198 H204	C67 H194 H198 H204

Gene Ontology

	Molecular Function
GO:0004175	endopeptidase activity
GO:0004222	metalloendopeptidase activity
GO:0004252	serine-type endopeptidase activity
GO:0005515	protein binding
GO:0008233	peptidase activity
GO:0008237	metallopeptidase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0002779	antibacterial peptide secretion
GO:0002780	antibacterial peptide biosynthetic process
GO:0006508	proteolysis
GO:0006509	membrane protein ectodomain proteolysis
GO:0009410	response to xenobiotic stimulus
GO:0022617	extracellular matrix disassembly
GO:0030198	extracellular matrix organization
GO:0030335	positive regulation of cell migration
GO:0030574	collagen catabolic process
GO:0031293	membrane protein intracellular domain proteolysis
GO:0042127	regulation of cell population proliferation
GO:0042742	defense response to bacterium
GO:0050829	defense response to Gram-negative bacterium
GO:0050830	defense response to Gram-positive bacterium

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0031012	extracellular matrix
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ue2, PDBe:5ue2, PDBj:5ue2
PDBsum	5ue2
PubMed	28648610
UniProt	P09237\|MMP7_HUMAN Matrilysin (Gene Name=MMP7)

[Back to BioLiP]