Structure of PDB 5udz Chain A

Receptor sequence

>5udzA (length=139) Species: 9606 (Homo sapiens)

DEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHME
GFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYN
CGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ

3D structure

• PDB: 5udz LIN28 Zinc Knuckle Domain Is Required and Sufficient to Induce let-7 Oligouridylation.
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	W46 F47 N48 V49 R50 M51 F53 F55 F73 H75 Q76 F84 R85 K102 G103 E105 K125	W14 F15 N16 V17 R18 M19 F21 F23 F41 H43 Q44 F52 R53 K70 G71 E73 K93	PDBbind-CN: Kd=92nM
BS02	rna	A	G136 R138 C139 Y140 H148 A149 Q157 K159 K160 C161 H162 F163 M170 V171 K177	G95 R97 C98 Y99 H107 A108 Q116 K118 K119 C120 H121 F122 M129 V130 K136	PDBbind-CN: Kd=92nM
BS03	ZN	A	C139 C142 H147 C152	C98 C101 H106 C111
BS04	ZN	A	C161 C164 H169 C174	C120 C123 H128 C133

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:5udz, PDBe:5udz, PDBj:5udz
• PDBsum: 5udz
• PubMed: 28297670
• UniProt: Q9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)