Structure of PDB 5uc6 Chain A

Receptor sequence
>5uc6A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence]
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGA
YKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETN
LLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQ
A
3D structure
PDB5uc6 Structural basis for IL-1 alpha recognition by a modified DNA aptamer that specifically inhibits IL-1 alpha signaling.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A M15 R16 K60 S61 K63 D64 D65 K67 I68 W113 M7 R8 K52 S53 K55 D56 D57 K59 I60 W105 PDBbind-CN: Kd=7.3nM
BS02 MG A K11 N13 K60 S61 S62 K3 N5 K52 S53 S54
BS03 MG A Y121 F122 T150 F152 Y113 F114 T142 F144
BS04 MG A Y39 L40 V90 V140 Y31 L32 V82 V132
BS05 MG A N108 L110 F111 S124 N100 L102 F103 S116
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005149 interleukin-1 receptor binding
Biological Process
GO:0006954 inflammatory response
GO:0006955 immune response
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uc6, PDBe:5uc6, PDBj:5uc6
PDBsum5uc6
PubMed28993621
UniProtP01583|IL1A_HUMAN Interleukin-1 alpha (Gene Name=IL1A)

[Back to BioLiP]