Structure of PDB 5u9b Chain A

Receptor sequence
>5u9bA (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRV
IACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKN
3D structure
PDB5u9b Structural Basis for Interaction of the Tandem Zinc Finger Domains of Human Muscleblind with Cognate RNA from Human Cardiac Troponin T.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A V3 S4 V5 I8 R9 D10 W13 L14 Q44 I51 A52 F54 R63 K67 Y68 E80 G83 R84 N86 L87 Q89 V3 S4 V5 I8 R9 D10 W13 L14 Q44 I51 A52 F54 R63 K67 Y68 E80 G83 R84 N86 L87 Q89 PDBbind-CN: Kd=130nM
BS02 ZN A C19 C27 C34 H38 C19 C27 C34 H38
BS03 ZN A C53 H70 C53 H70
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5u9b, PDBe:5u9b, PDBj:5u9b
PDBsum5u9b
PubMed28718627
UniProtQ9NR56|MBNL1_HUMAN Muscleblind-like protein 1 (Gene Name=MBNL1)

[Back to BioLiP]