Structure of PDB 5u2j Chain A

Receptor sequence

>5u2jA (length=111) Species: 9606 (Homo sapiens)

MDPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNV
KALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPK
GMWICQVCRPK

3D structure

• PDB: 5u2j Recognition of Histone H3K14 Acylation by MORF.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S210 F211 L213 S235 S236 C241 L242 K243 I260 E261 A275 D276 M278 L279 F280 D282 D285 M300 P301 G303	S8 F9 L11 S33 S34 C39 L40 K41 I58 E59 A73 D74 M76 L77 F78 D80 D83 M98 P99 G101
BS02	ZN	A	C281 C284 C307 C310	C79 C82 C105 C108
BS03	ZN	A	C265 C268 H289 C292	C63 C66 H87 C90
BS04	ZN	A	C209 C212 H238 C241	C7 C10 H36 C39
BS05	ZN	A	C230 C233 C259 C262	C28 C31 C57 C60

External links

• PDB: RCSB:5u2j, PDBe:5u2j, PDBj:5u2j
• PDBsum: 5u2j
• PubMed: 28286003
• UniProt: Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B (Gene Name=KAT6B)