Structure of PDB 5txx Chain A

Receptor sequence

>5txxA (length=329) Species: 9606 (Homo sapiens)

WMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVL
KALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQT
MKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLIT
HPKEGQEAGLLPRVMCRLQDQGLILYHQHQAFERSFCIFRLPQPGSWKAV
RVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPE
QKTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 5txx Time-lapse crystallography snapshots of a double-strand break repair polymerase in action.
• Chain: A
• Resolution: 1.948 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D330 D332 D418
• Catalytic site (residue number reindexed from 1): D194 D196 D253
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 F385 E386 R387 R442 R445 R449 K450 L456 N457 H459	L41 F232 E233 R234 R277 R280 R284 K285 L291 N292 H294
BS02	dna	A	G245 V246 G247 T250 F389 R416 D418 W434	G109 V110 G111 T114 F236 R251 D253 W269
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G38 R39 T42 F43 H68 G70 H72 S73
BS04	TTP	A	G319 G320 R323 K325 H329 D330 D332 G433 G436 K438	G183 G184 R187 K189 H193 D194 D196 G268 G271 K273
BS05	CA	A	D330 D332	D194 D196
BS06	CA	A	D330 D332 D418	D194 D196 D253

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5txx, PDBe:5txx, PDBj:5txx
• PDBsum: 5txx
• PubMed: 28811466
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)