Structure of PDB 5tx6 Chain A |
>5tx6A (length=88) Species: 10090 (Mus musculus) [Search protein sequence] |
ALDAAYCFRNVQDNCCLRPLYIDFRKDLGWKWIHEPKGYNANFCAGACPK SPSCVSQDLEPLTIVYYVGRKPKVEQLSNMIVKSCKCS |
|
PDB | 5tx6 An engineered transforming growth factor beta (TGF-beta ) monomer that functions as a dominant negative to block TGF-beta signaling. |
Chain | A |
Resolution | 2.746 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E99 Q100 |
E75 Q76 |
|
|
|
|