Structure of PDB 5twt Chain A

Receptor sequence

>5twtA (length=291) Species: 38727 (Panicum virgatum)

QLSSTFYDTSCPNALSTIRSAVNAAVAQENRMGASLLRLHFHDCFVQGCD
ASVLLNDTNGGEQNALPNAGSLRGFGVIDNIKAQVEALCPQTVSCADILA
VAARDSVVALGGPSWTVPLGRRDSTNSSAALANSDLPPPQFNLSQLITAF
GNKNLDPTDLVALSGAHTIGQAQCLNFRAHITEPNINPTFAASLRANCPA
TGGDTNLAPLDVTTPNTFDNAYYTNLLNQRGLLHSDQELFNNASTDSTVR
NFASNAAAFTTAFTTAMIKMGNLQPLTGTQGQIRRNCWRVN

3D structure

• PDB: 5twt Characterization of Class III Peroxidases from Switchgrass.
• Chain: A
• Resolution: 1.296 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G60 A162
• Catalytic site (residue number reindexed from 1): G60 A162
• Enzyme Commision number: 1.11.1.7: peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	R31 A34 S35 R38 F41 S71 P137 P138 P139 F150 A166 H167 G170 Q171 A172 Q173 N176 L210 L233 S235	R31 A34 S35 R38 F41 S71 P137 P138 P139 F150 A166 H167 G170 Q171 A172 Q173 N176 L210 L233 S235
BS02	CA	A	T168 D211 T214 T217 D219	T168 D211 T214 T217 D219
BS03	CA	A	D43 V46 G48 D50 S52	D43 V46 G48 D50 S52

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0140825 lactoperoxidase activity

Biological Process

• GO:0006979 response to oxidative stress
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:5twt, PDBe:5twt, PDBj:5twt
• PDBsum: 5twt
• PubMed: 27879392
• UniProt: A0A1S4NYF8