Structure of PDB 5tws Chain A

Receptor sequence

>5twsA (length=325) Species: 9606 (Homo sapiens)

MPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLK
ALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTM
KLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLS
TPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGADVDFLITH
PKEGQEAGLLPRVMCRLQDQGLILYHQFERSFCIFRLPQPGSWKAVRVDL
VVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQKTF
FQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 5tws Structural accommodation of ribonucleotide incorporation by the DNA repair enzyme polymerase Mu.
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D330 D332 D418
• Catalytic site (residue number reindexed from 1): D193 D195 D249
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 F385 E386 R387 R442 R445 R449 K450 L456 N457 H459	L40 F228 E229 R230 R273 R276 R280 K281 L287 N288 H290
BS02	dna	A	G245 V246 G247 K249 T250 D330 D332 F389 R416 D418 G433 W434 T435 G436 K438	G108 V109 G110 K112 T113 D193 D195 F232 R247 D249 G264 W265 T266 G267 K269
BS03	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G37 R38 T41 F42 H67 G69 H71 S72
BS04	MG	A	D330 D332	D193 D195
BS05	GOA	A	G319 G320 R323 D330	G182 G183 R186 D193

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5tws, PDBe:5tws, PDBj:5tws
• PDBsum: 5tws
• PubMed: 28911097
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)