Structure of PDB 5tuy Chain A

Receptor sequence

>5tuyA (length=267) Species: 9606 (Homo sapiens)

IICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITH
LQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQA
CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGE
LISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNII
PVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQC
GSEKCKHSAEAIALEQS

3D structure

• PDB: 5tuy Discovery of Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase.
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1067 Y1154
• Catalytic site (residue number reindexed from 1): Y147 Y234
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C980 C1017 C1023 C1027	C60 C97 C103 C107
BS02	ZN	A	C974 C987 C1017 C1021	C54 C67 C97 C101
BS03	ZN	A	C974 C976 C980 C985	C54 C56 C60 C65
BS04	ZN	A	C1115 C1168 C1170 C1175	C195 C248 C250 C255
BS05	SAM	A	M1048 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168 Q1169	M128 W130 S164 Y165 R189 F190 N192 H193 Y234 F246 C248 Q249
BS06	7L6	A	D1074 A1077 D1078 R1080 D1083 L1086 D1088 R1157 F1158	D154 A157 D158 R160 D163 L166 D168 R237 F238	PDBbind-CN: -logKd/Ki=6.35,Kd=445nM BindingDB: IC50=1.6nM,Kd=445nM

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5tuy, PDBe:5tuy, PDBj:5tuy
• PDBsum: 5tuy
• PubMed: 28135087
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)