Structure of PDB 5tr9 Chain A

Receptor sequence
>5tr9A (length=246) Species: 1351790 (Neisseria gonorrhoeae MIA_2011_03-10) [Search protein sequence]
EAKFTEEKILWVKHHTPKLITFAISRPESYRFKAGQFSRLGFYEGKGFIW
RAYSVVSAEYADTLEYFAVLIQDGPMSALFAKMQQGDTILLDKNATGFLL
PERFPDGKDLVMLCTGSGIAPFLSILEQPEIRQRFDTVNLIHSVSFPEEL
IFNDRLAALSEHSFRFVPVTTRAANPSGLSGKRIPELLKNNSIEQALHTK
LTPESTRFMICGNPEMVKDTFQTLLDMGYAMHRNRIPGQIMMENGF
3D structure
PDB5tr9 Crystal Structure of a ferredoxin NADP+ reductase from Neisseria gonorrhoeae with bound FAD
ChainA
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FAD A F50 R64 A65 Y66 S67 F80 A81 I84 G87 P88 M89 S90 S130 G266 F267 F37 R51 A52 Y53 S54 F67 A68 I71 G74 P75 M76 S77 S117 G245 F246
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Feb 21 21:10:45 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5tr9', asym_id = 'A', title = 'Crystal Structure of a ferredoxin NADP+ reductase from Neisseria gonorrhoeae with bound FAD'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5tr9', asym_id='A', title='Crystal Structure of a ferredoxin NADP+ reductase from Neisseria gonorrhoeae with bound FAD')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004324,0016491', uniprot = '', pdbid = '5tr9', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004324,0016491', uniprot='', pdbid='5tr9', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>