Structure of PDB 5tkl Chain A

Receptor sequence

>5tklA (length=350) Species: 5811 (Toxoplasma gondii)

MSGYGLPISQEVAKELAENARKIAAPGKGILAADESTGTIKKRFDSIGVE
NTEANRAFYRDLLFSTKGLGQYISGAILFEETLYQKSPSGVPMVDLLKAE
GIIPGIKVDKGLETLPLTDDEKATMGLDGLSERCKKYYEAGARFAKWRAV
LSIDPAKGKPTNLSITEVAHGLARYAAICQANRLVPIVEPEILTDGSHDI
TVCAEVTERVLAAVFKALNDHHVLLEGALLKPNMVTHGSDCPKPASHEEI
AFYTVRSLKRTVPPALPGVMFLSGGQSEEDASLNLNEMNKMGPHPFQLSF
SYGRALQASCLKAWKGVPENKAKAQQVLMERARANGEAQLGKYGGGAYVY

3D structure

• PDB: 5tkl Isomer activation controls stereospecificity of class I fructose-1,6-bisphosphate aldolases.
• Chain: A
• Resolution: 1.751 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D34 K146 E189 E191 K231 S301 Y363
• Catalytic site (residue number reindexed from 1): D34 K146 E189 E191 K231 S301 Y350
• Enzyme Commision number: 4.1.2.13: fructose-bisphosphate aldolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	P6F	A	A32 D34 S36 T39 K107 K146 R148 E189 K231 S273 G274 G303 R304	A32 D34 S36 T39 K107 K146 R148 E189 K231 S273 G274 G303 R304
BS02	G3H	A	S36 T39 K107 K146 R148 E189 K231	S36 T39 K107 K146 R148 E189 K231

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0004332 fructose-bisphosphate aldolase activity
• GO:0016829 lyase activity

Biological Process

• GO:0006096 glycolytic process
• GO:0030388 fructose 1,6-bisphosphate metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5tkl, PDBe:5tkl, PDBj:5tkl
• PDBsum: 5tkl
• PubMed: 28972169
• UniProt: Q8I8I2|ALF1_TOXGO Fructose-bisphosphate aldolase 1 (Gene Name=ald-1)