Structure of PDB 5th3 Chain A

Receptor sequence

>5th3A (length=226) Species: 1292 (Staphylococcus warneri)

MNFKKYEENLVASIEEVIQRIIDDKHRPNIIGKTRVGAEVSDYLEDEFVK
YISSGKSSSLYDAQGAPKEKTKNPWDARCKFKFMDREEEIWIDFKAFKIT
NMDSNPDIGTPNKIVKFIHEGNFYLVFVLVYYESKQDGVEFVKYNNDYKK
VYLLKDVNESFRINPKPQMQVNIAAEPTYRTREEFIHFFVKKWKESFERQ
IKSLEKKEIMLKDLEDKLKNSNDNSI

3D structure

• PDB: 5th3 DNA recognition by the SwaI restriction endonuclease involves unusual distortion of an 8 base pair A:T-rich target.
• Chain: A
• Resolution: 2.33 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	T71 K72 G109 T110 N112 K113 Q168	T71 K72 G109 T110 N112 K113 Q168
BS02	dna	A	R35 S41 K95 A96 F97 K98 N101 M102 D103 S104 N105 P106 D107 Q170	R35 S41 K95 A96 F97 K98 N101 M102 D103 S104 N105 P106 D107 Q170
BS03	dna	A	R35 R162 N164 K166 Q170 R199	R35 R162 N164 K166 Q170 R199
BS04	dna	A	R35 K70 T71 K72	R35 K70 T71 K72
BS05	MG	A	D76 D93 F94	D76 D93 F94

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

External links

• PDB: RCSB:5th3, PDBe:5th3, PDBj:5th3
• PDBsum: 5th3
• PubMed: 28180307
• UniProt: A0A1S4NYF7