Structure of PDB 5tdc Chain A

Receptor sequence
>5tdcA (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]
LCGRVFKSGETTYSCRDCAIDPTCVLCMDCFQDSVHKNHRYKMHTSTGGG
FCDCGDTEAWKTGPFCVNHE
3D structure
PDB5tdc Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.
ChainA
Resolution1.607 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T120 V122 H141 G147 F148 D150 D153 E155 T23 V25 H44 G50 F51 D53 D56 E58
BS02 ZN A C99 C124 C127 C149 C2 C27 C30 C52
BS03 ZN A C127 C151 C163 H166 C30 C54 C66 H69
BS04 ZN A C112 C115 H133 H136 C15 C18 H36 H39
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5tdc, PDBe:5tdc, PDBj:5tdc
PDBsum5tdc
PubMed28392261
UniProtQ8IWV7|UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)

[Back to BioLiP]