Structure of PDB 5tda Chain A

Receptor sequence
>5tdaA (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
SLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGG
GFCDCGDTEAWKEGPYCQKHE
3D structure
PDB5tda Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.
ChainA
Resolution0.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T120 V122 G147 F148 D150 D153 T24 V26 G51 F52 D54 D57
BS02 ZN A C99 C124 C127 C149 C3 C28 C31 C53
BS03 ZN A C127 C151 C163 H166 C31 C55 C67 H70
BS04 ZN A C112 C115 H133 H136 C16 C19 H37 H40
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5tda, PDBe:5tda, PDBj:5tda
PDBsum5tda
PubMed28392261
UniProtQ8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 (Gene Name=UBR2)

[Back to BioLiP]