Structure of PDB 5tcm Chain A |
>5tcmA (length=116) Species: 981087 (Leishmania donovani BPK282A1) [Search protein sequence] |
YFQGYNEADVAALVRSLDRAEDHHIFAVDVLETYPYLAESYTKVCPRRCD LATAAQKALEGAYSYDLRLEGLKADIALMASNCVAYNGPTSAYAETAAKF ERYALEQIDAFVLEHN |
|
PDB | 5tcm First Bromodomain from Leishmania donovani LdBPK.091320 complexed with BI-2536 |
Chain | A |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
R78 |
A |
H24 I25 Y86 Y93 |
H24 I25 Y86 Y93 |
|
|
|